Recombinant Human LOX-1/OLR1 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01189-10, RP01189-20, RP01189-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human LOX-1/OLR1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser61-Gln273) of human LOX-1/OLR1 (Accession #NP_002534.1) fused with a 6×His tag at the C-terminus.
Alternate Names: OLR1, CLEC8A, LOX1, LOXIN, SCARE1, SLOX1
SWISS: P78380
GeneID: 4973
Species: Human
Purity: ≥ 85 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human OLR1 (Catalog: RP01189) at 1 μg/mL (100 μL/well) can bind Anti-hLOX-1/OLR1 with a linear range of 0.049-3.66 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only