Skip to product information
1 of 1

ABclonal

Recombinant Human LR3-IGF-1(E51R) Protein - RP00825

Recombinant Human LR3-IGF-1(E51R) Protein - RP00825

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human LR3-IGF-1(E51R) Protein

Sizes: 50ug, 100ug

Catalogue Number: RP00825-50, RP00825-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LR3-IGF-1(E51R) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly49-Ala118) of human IGF-1 (Accession #P05019) with the substitution of an Arg for Glu at position three and the addition of a thirteen aa N-terminal extension.

Alternate Names: IGF1, IBP1, IGF-1, Insulin-like growth factor 1, Insulin-like growth factor I, IGF-I, Mechano growth factor, MGF, Somatomedin-C

SWISS: P05019

GeneID: 3479

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Long R3 IGF-1 (LR3 IGF-1) is a synthetic analog of IGF-1 that is generated by modifying the AA sequence for mature human IGF-1. These modifications include the substitution of an Arg for Glu at position three of the mature IGF-1 sequence and the addition of a thirteen aa N-terminal extension, which is derived from methionyl porcine Growth Hormone. These aa changes generate a protein that is still capable of binding to IGF-1 and Insulin receptors, but shows considerably lower affinity binding to IGFBPs compared to wild-type IGF-1. As a result, LR3 IGF-1 has an increased half-life and displays increased biological potency compared to IGF-1.

Bio-Activity: 1、Measured in a cell proliferation assay using FDC-P1 cells. The ED50 for this effect is 9.85-39.4 ng/mL, corresponding to a specific activity of 2.54×10^4 ~1.01×10^5 units/mg.

Source: E. coli

Tag: NO-Tag

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details