Recombinant Human LRG1(P133S) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01986-10, RP01986-20, RP01986-50, RP01986-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human LRG1(P133S) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Vla36-Gln347 (Pro133Ser) ) of Human LRG1(P133S) (Accession #NP_443204.1) fused with His tag at the C-terminus.
Alternate Names: LRG1, LRG, Leucine-rich alpha-2-glycoprotein, LRG
SWISS: P02750
GeneID: 116844
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Diabetic nephropathy (DN) is an important public health concern of increasing proportions and the leading cause of end-stage renal disease (ESRD) in diabetic patients. It is one of the most common long-term microvascular complications of diabetes mellitus that is characterized by proteinuria and glomerular structural changes. LRG1 is a novel pro-angiogenic factors involved in the abnormal angiogenesis and renal fibrosis in DN.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only