ABclonal
Recombinant Human LRRC4 Protein - RP01194
Recombinant Human LRRC4 Protein - RP01194
Couldn't load pickup availability
Recombinant Human LRRC4 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01194-10, RP01194-20, RP01194-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human LRRC4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala39-Lys527) of human LRRC4 (Accession #NP_071426.1.) fused with a 6×His tag at the C-terminus.
Alternate Names: LRRC4, NAG14, NGL-2
SWISS: Q9HBW1
GeneID: 64101
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: ASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTK
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
