Skip to product information
1 of 1

ABclonal

Recombinant Human LRRC4 Protein - RP01194

Recombinant Human LRRC4 Protein - RP01194

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human LRRC4 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP01194-10, RP01194-20, RP01194-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LRRC4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala39-Lys527) of human LRRC4 (Accession #NP_071426.1.) fused with a 6×His tag at the C-terminus.

Alternate Names: LRRC4, NAG14, NGL-2

SWISS: Q9HBW1

GeneID: 64101

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: ASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTK

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details