Recombinant Human Lumican/LUM Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00216-10, RP00216-20, RP00216-50, RP00216-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Lumican/LUM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Asn338) of human Lumican/LUM (Accession #NP_002336.1) fused with a 6×His tag at the C-terminus.
Alternate Names: LDC, SLRR2D, LUM, SLRR2D, lumican
SWISS: P51884
GeneID: 4060
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Lumican is a member of the family of small leucine-rich repeat proteoglycans (SLRPs) and the class II subfamily.which is a major component of the cornea, dermal, and muscle connective tissues. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and is also present in the connective tissues of other organs and embryonic corneal stroma as a glycoprotein. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. Lumican’s over-expression has been reported in carcinoid tumor, breast, colorectal, neuroendocrine, uterine cervical and pancreatic cancers
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only