Skip to product information
1 of 1

ABclonal

Recombinant Human Lung surfactant protein D/SFTPD(E22G) Protein - RP00117

Recombinant Human Lung surfactant protein D/SFTPD(E22G) Protein - RP00117

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Lung surfactant protein D/SFTPD(E22G) Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00117-10, RP00117-20, RP00117-50, RP00117-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Lung surfactant protein D/SFTPD(E22G) Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala21-Phe375 (Glu22Gly)) of human SFTPD/SP-D/SFTP4 (Accession #NP_003010.4) fused with a 6×His tag at the C-terminus.

Alternate Names: SFTPD, COLEC7, PSP-D, SFTP4, SP-D

SWISS: P35247

GeneID: 6441

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The protein encoded by this gene is part of the innate immune response, protecting the lungs against inhaled microorganisms and chemicals. The encoded protein may also be involved in surfactant metabolism.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details