ABclonal
Recombinant Human Lung surfactant protein D/SFTPD(E22G) Protein - RP00117
Recombinant Human Lung surfactant protein D/SFTPD(E22G) Protein - RP00117
Couldn't load pickup availability
Recombinant Human Lung surfactant protein D/SFTPD(E22G) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00117-10, RP00117-20, RP00117-50, RP00117-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Lung surfactant protein D/SFTPD(E22G) Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala21-Phe375 (Glu22Gly)) of human SFTPD/SP-D/SFTP4 (Accession #NP_003010.4) fused with a 6×His tag at the C-terminus.
Alternate Names: SFTPD, COLEC7, PSP-D, SFTP4, SP-D
SWISS: P35247
GeneID: 6441
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein encoded by this gene is part of the innate immune response, protecting the lungs against inhaled microorganisms and chemicals. The encoded protein may also be involved in surfactant metabolism.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
