WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human LYPD3 Protein - RP01190

Recombinant Human LYPD3 Protein - RP01190

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Human LYPD3 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01190-10, RP01190-20, RP01190-50, RP01190-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LYPD3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu31-His286) of human LYPD3/C4.4A (Accession #NP_055215.2.) fused with a 6×His tag at the C-terminus.

Alternate Names: LYPD3, C4.4A

SWISS: O95274

GeneID: 27076

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human LYPD3 Protein at 1μg/mL (100 μL/well) can bind LYPD3 Rabbit pAb with a linear range of 0.06-3.84 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEH

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only