Recombinant Human Macrophage migration inhibitory factor/MIF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02895-10, RP02895-20, RP02895-50, RP02895-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant human Macrophage migration inhibitory factor/MIF Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Ala115) of human Macrophage migration inhibitory factor/MIF (Accession #NP_002406.1) fused with a 6×His tag at the N-terminus.
Alternate Names: GIF, GLIF, MMIF, MIF, GLIF, MMIF
SWISS: P14174
GeneID: 4282
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: MIF (or macrophage migration inhibitory factor) was the first lymphokine/cytokine to be recognized in the pregenomics era. Regardless, it is one of the least understood of all inflammatory mediators. Secretion occurs nonclassically via an ABCA1 transporter. The molecule consists of two alpha -helices and six beta -strands, four of which form a beta -sheet. The two remaining beta -strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position #1. Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity.
Source: E. coli
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM PB,150mM NaCl,pH7.4/20mM PB,150mM NaCl,pH7.4,50% glycerol
Antigen Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only