Recombinant Human Mature BMP-7 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02513S-10, RP02513S-20, RP02513S-50, RP02513S-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human BMP-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser293-His431) of Human BMP-7(Accession #NP_001710.1) fused with No Tag.
Alternate Names: BMP7, OP1, Bone morphogenetic protein 7, BMP-7, Osteogenic protein 1, OP-1, Eptotermin alfa
SWISS: P18075
GeneID: 655
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: BMP-7 (Bone morphogenetic protein 7) is a bone morphogenetic protein which belongs to the TGF-β superfamily. OP-1 is expressed in the brain, kidneys, and bladder. BMP-7 may be involved in bone homeostasis and plays a key role in the transformation of mesenchymal cells into bone and cartilage. The phosphorylation of SMAD1 and SMAD5 can be induced by BMP-7, which in turn induce transcription of numerous osteogenic genes. BMP-7 treatment can also induce all of the genetic markers of osteoblast differentiation in many cell types. Human recombinant BMP-7 protein can be used to aid in the fusion of vertebral bodies to prevent neurologic trauma. It also functions in the treatment of tibial non-union, frequently in cases where a bone graft has failed. It is found that BMP7 has the potential for treatment of chronic kidney disease.
Bio-Activity: Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells.The ED50 for this effect is 34.9-139.58 ng/mL, corresponding to a specific activity of 7.2×10^3 ~2.87×10^4 units/mg.
Source: HEK293 cells
Tag: No-Tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM acetic acid, pH3.6.
Antigen Sequence: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only