ABclonal
Recombinant Human Mature BMP-9/GDF-2 Protein - RP00722
Recombinant Human Mature BMP-9/GDF-2 Protein - RP00722
Couldn't load pickup availability
Recombinant Human Mature BMP-9/GDF-2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00722-10, RP00722-20, RP00722-50, RP00722-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Mature BMP-9/GDF-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser320-Arg429) of Human Mature BMP-9/GDF-2 (Accession # Q9UK05) fused with no tag.
Alternate Names: GDF2, BMP9, Growth/differentiation factor 2, GDF-2, Bone morphogenetic protein 9, BMP-9
SWISS: Q9UK05
GeneID: 2658
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: BMP-9 is a member of the BMP subgroup of the TGF-beta superfamily proteins that signal through heterodimeric complexes composed of type I and type II BMP receptors. GDF-2 Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG. ALK1 is a signalling receptor for bone morphogenetic protein-9 (BMP-9) in endothelial cells (ECs). BMP-9 bound with high affinity to ALK1 and endoglin, and weakly to the type-I receptor ALK2 and to the BMP type-II receptor (BMPR-II) and activin type-II receptor (ActR-II) in transfected COS cells.
Source: HEK293 cells
Tag: NO-Tag
Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).
Antigen Sequence: SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
