WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Mature GDNF Protein - RP00835

Recombinant Human Mature GDNF Protein - RP00835

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Mature GDNF Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00835-10, RP00835-20, RP00835-50, RP00835-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human GDNF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser78-Ile211) of human GDNF (Accession #P39905).

Alternate Names: GDNF, Glial cell line-derived neurotrophic factor, hGDNF, Astrocyte-derived trophic factor, ATF

SWISS: P39905

GeneID: 2668

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Glial cell line-derived neurotrophic factor(GDNF) is an important member of the GDNF family of ligands(GFL). The GDNF family of ligands is comprised by four neurotrophic factors: glial cell line-derived neurotrophic factor (GDNF), neurturin (NRTN), artemin (ARTN), and persephin (PSPN). It has been found that GFLs play a role in a number of biological processes including cell survival, neurite outgrowth, cell differentiation and cell migration. As the founding member, GDNF plays a key role in the promotion of the survival of dopaminergic neurons. GDNF is a highly conserved neurotrophic factor. The recombinant form of this protein also promotes the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. GDNF also regulates kidney development and spermatogenesis, and it affects alcohol consumption. It has been shown that GDNF results in two Parkinson's disease clinical trial and in a number of animal trials. It has been taken as a po

Bio-Activity: Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.82-7.26 ng/mL in the presence of Recombinant Human GFR alpha ‑1 (Catalog # RP01970), corresponding to a specific activity of 1.38×10^5 ~5.49×10^5 units/mg.

Source: E. coli

Tag: NO-Tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only