WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Mature MIS/AMH Protein - RP01956

Recombinant Human Mature MIS/AMH Protein - RP01956

Regular price
$315.00
Regular price
Sale price
$315.00
Unit price
per 
Availability
Sold out

Recombinant Human Mature MIS/AMH Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01956-10, RP01956-20, RP01956-50, RP01956-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Mature MIS/AMH Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser452-Arg560)of Human Mature MIS/AMH (Accession #NP_000470.2) fused with No Tag.

Alternate Names: Muellerian-inhibiting factor, Anti-Muellerian hormone, AMH, Muellerian-inhibiting substance, MIS, AMH, MIF

SWISS: P03971

GeneID: 268

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Anti-Mullerian hormone (AMH), a member of the TGF-beta superfamily, is produced by granulosa cells (GCs) of preantral and small antral follicles and plays a role in regulating the recruitment of primordial follicles and the FSH-dependent development of follicles. BMP15 up-regulates the transcription of AMH and that the inhibition of p38 MAPK decreases the BMP15-induced expression of AMH and SOX9, suggesting that BMP15 up-regulates the expression of AMH via the p38 MAPK signaling pathway, and this process involves the SOX9 transcription factor. AMH is widely used for assessing ovarian reserve, and it is particularly convenient, because it is thought to have minimal variability throughout the menstrual cycle. Fetal anti-Mullerian hormone (AMH) is responsible for normal male sexual differentiation, and circulating AMH is used as a marker of testicular tissue in newborns with disorders of sex development. Anti-Mullerian hormone (AMH) produced in the developing testis induces the regression of the Mullerian duct, which develops into the oviducts, uterus and upper vagina. As well as other hormone receptors, and a decreased ovarian cortex cell proliferation. These results help understand the inhibitory effects of AMH on follicular development.

Source: HEK293 cells

Tag: No-Tag

Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM acetic acid, pH 3.0.

Antigen Sequence: SAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQVRGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only