ABclonal
Recombinant Human Mature TGF-beta 1 Protein - RP01458
Recombinant Human Mature TGF-beta 1 Protein - RP01458
Couldn't load pickup availability
Recombinant Human Mature TGF-beta 1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01458-10, RP01458-20, RP01458-50, RP01458-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Mature TGF-beta 1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala279-Ser390) of human Mature TGF-beta 1 (Accession #NP_000651.3) fused with no tag.
Alternate Names: TGFB1, CED, DPD1, LAP, TGFB, TGFbeta, transforming growth factor beta-1, TGF-beta 1, CED, DPD1, LAP, TGFB, TGFbeta, TGF-β
SWISS: P01137
GeneID: 7040
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: TGF-beta 1 is a member of the transforming growth factor beta (TGF-beta) family. The transforming growth factor-beta family of polypeptides are involved in the regulation of cellular processes, including cell division, differentiation, motility, adhesion and death. TGF-beta 1 positively and negatively regulates many other growth factors. It inhibits the secretion and activity of many other cytokines including interferon-γ, tumor necrosis factor-alpha and various interleukins. It can also decrease the expression levels of cytokine receptors. Meanwhile, TGF-beta 1 also increases the expression of certain cytokines in T cells and promotes their proliferation, particularly if the cells are immature. TGF-beta 1 also inhibits proliferation and stimulates apoptosis of B cells, and plays a role in controlling the expression of antibody, transferrin and MHC class II proteins on immature and mature B cells. As for myeloid cells, TGF-beta 1can inhibit their proliferation and prevent their production of reactive oxygen and nitrogen intermediates. However, as with other cell types, TGF-beta 1 also has the opposite effect on cells of myeloid origin. TGF-beta 1 is a multifunctional protein that controls proliferation, differentiation and other functions in many cell types. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. Once cells lose their sensitivity to TGF-beta1-mediated growth inhibition, autocrine TGF-beta signaling can promote tumorigenesis. Elevated levels of TGF-beta1 are often observed in advanced carcinomas, and have been correlated with increased tumor invasiveness and disease progression.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human TGF-beta 1 at 2 μg/mL (100 μL/well) can bind Human TGFBR2 with a linear range of 0.78-11 ng/mL.|2.Measured by its ability to inhibit the IL-4(Catalog: RP01161)-dependent proliferation of HT‑2 mouse T cells. The ED50 for this effect is 12.85-51.40 pg/mL, corresponding to a specific activity of 1.95×10^7~7.78×10^7 units/mg.
Source: HEK293 cells
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 50 mM Glycine,150 mM NaCl,pH3.5.
Antigen Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Endotoxin: < 0.01 EU/μg of the protein by LAL method.
Research Use Only
