ABclonal
Recombinant Human Mature TGF-beta 2 Protein - RP00452
Recombinant Human Mature TGF-beta 2 Protein - RP00452
Couldn't load pickup availability
Recombinant Human Mature TGF-beta 2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00452-10, RP00452-20, RP00452-50, RP00452-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TGF-beta 2 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Ala303-Ser414) of human TGF-beta 2/TGFB2 (Accession #P61812).
Alternate Names: TGFB2, G-TSF, LDS4, TGF-beta2
SWISS: P61812
GeneID: 7042
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein belongs a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1; 7)(q41; p21) between this gene and HDAC9 is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified.
Bio-Activity: Recombinant Human Mature TGF-beta 2 Protein inhibit the IL-4-dependent proliferation of HT-2 mouse T cells. The ED50 for this effect is 0.058-0.232 ng/mL, corresponding to a specific activity of 4.3×106~1.72×107 units/mg.
Source: HEK293 cells
Tag: No tag
Formulation: Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.Contact us for customized product form or formulation.
Antigen Sequence: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
