Skip to product information
1 of 1

BioWorld

Recombinant Human MCP-4 (rHuMCP-4/CCL13 ) - PR1088

Recombinant Human MCP-4 (rHuMCP-4/CCL13 ) - PR1088

Regular price $260.23 CAD
Regular price Sale price $260.23 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human MCP-4 (rHuMCP-4/CCL13 )

Catalogue Numbers: PR1088-5, PR1088-20

Sizes: 5µg, 20µg

Source: Escherichia coli

Molecular Weight: 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.

Purity: >96% by SDS-PAGE and HPLC analyses.

Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of >1 x 104 IU/mg.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.

AA Sequence: QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Endotoxin: Less than 1EU/mg of rHuMCP-4/CCL13 as determined by LAL method.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

Description: CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13.

View full details