Skip to product information
1 of 1

ABclonal

Recombinant Human Microtubule-associated protein tau/MAPT Protein - RP01804

Recombinant Human Microtubule-associated protein tau/MAPT Protein - RP01804

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Microtubule-associated protein tau/MAPT Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01804-10, RP01804-20, RP01804-50, RP01804-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Microtubule-associated protein tau/MAPT Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln88-Arg230) of human Microtubule-associated protein tau/MAPT (Accession #) fused with hFc tag at the C-terminus.

Alternate Names: TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; tau-40; FTDP-17; PPP1R103; Tau-PHF6

SWISS: P10636-8

GeneID: 4137

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Tau proteins are proteins that stabilize microtubules. They are abundant in neurons of the central nervous system and are less common elsewhere, but are also expressed at very low levels in CNS astrocytes and oligodendrocytes. When tau proteins are defective, and no longer stabilize microtubules properly, they can result in dementias such as Alzheimer's disease. Tau protein is a highly soluble microtubule-associated protein (MAP). In humans, these proteins are mostly found in neurons compared to non-neuronal cells. One of tau's main functions is to modulate the stability of axonal microtubules. Other nervous system MAPs may perform similar functions, as suggested by tau knockout mice, who did not show abnormalities in brain development - possibly because of compensation in tau deficiency by other MAPs.

Source: HEK293 cells

Tag: C-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVR

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details