Skip to product information
1 of 1

ABclonal

Recombinant Human MMP-1 Protein - RP00211

Recombinant Human MMP-1 Protein - RP00211

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human MMP-1 Protein

Sizes: 10ug, 20ug, 100ug

Catalogue Numbers: RP00211-10, RP00211-20, RP00211-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human MMP1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Asn469) of human MMP1 (Accession #NP_002412.1) fused with a 6×His tag at the C-terminus.

Alternate Names: MMP1, CLG, CLGN

SWISS: P03956

GeneID: 4312

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: MMP1, also known as MMP-1, contains 4 hemopexin-like domains and is a member of the matrix metalloproteinase (MMP) family. Matrix metalloproteases, also called matrixins, are zinc-dependent endopeptidases that are the major proteases involved in ECM degradation. MMPs are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. MMP1 is expressed by fibroblasts, keratinocytes, endothelial cells, monocytes and macrophages.Mutations of MMP1 are associated with chronic obstructive pulmonary disease (COPD).

Bio-Activity: 1.Measured in a cell migration assay using A549 cells. 1 ng/mL of Recombinant Human MMP-1 can effectively induce A549 cells migration.|2.Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is >997 pmol/min/μg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details