Skip to product information
1 of 1

ABclonal

Recombinant Human MMP-3 Protein - RP00220

Recombinant Human MMP-3 Protein - RP00220

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human MMP-3 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00220-10, RP00220-20, RP00220-50, RP00220-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human MMP-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr18-Cys477) of human MMP-3 (Accession #NP_002413.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CHDS6, MMP-3, SL-1, STMY, STMY1, STR1, MMP3, MMP-3, SL-1, STMY, STMY1, STR1

SWISS: P08254

GeneID: 4314

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Matrix metallopeptidase 3 (abbreviated as MMP3) is also known as stromelysin 1 and progelatinase.MMP3 is a member of the matrix metalloproteinase (MMP) family whose members are involved in involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.

Bio-Activity: Measured by its ability to cleave the fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The specific activity is >500 pmol/min/μg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: YPLDGAARGEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details