ABclonal
Recombinant Human MMP-7 Protein - RP01770LQ
Recombinant Human MMP-7 Protein - RP01770LQ
Couldn't load pickup availability
Recombinant Human MMP-7 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01770LQ-10, RP01770LQ-20, RP01770LQ-50, RP01770LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human MMP-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr97-Lys267) of human MMP7 (Accession #NP_002414.1) fused with hFc tag at the C-terminus.
Alternate Names: MMP7, MPSL1, PUMP1, Matrilysin, Matrix metalloproteinase-7, MMP-7
SWISS: P09237
GeneID: 4316
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: Matrix metalloproteinase-7 (MMP-7) also known as neutrophil collagenase and CLG1, is a member of matrix metalloproteinases (MMPs) family, which degrade components of the extracellular matrix (ECM) and play essential roles in various physiological processes as well as pathological processes. MMP-7 may affect the metastatic behavior of breast cancer cells through protection against lymph node metastasis, underlining the importance of anti-target identification in drug development. MMP-7 in the tumor may have a protective effect against lymph node metastasis.
Source: HEK293 cells
Tag: C-hFC
Formulation: Supplied as a 0.22 μm filtered solution in 10mM HEPES 150mM NaCl 10%glycerol PH7.5.
Antigen Sequence: YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
