ABclonal
Recombinant Human MMP-7 Protein - RP01928
Recombinant Human MMP-7 Protein - RP01928
Couldn't load pickup availability
Recombinant Human MMP-7 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01928-10, RP01928-20, RP01928-50, RP01928-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Recombinant Human MMP-7 Protein is produced by CHO Cells expression system. The target protein is expressed with sequence (Met1-Lys267) of Human MMP-7 (Accession #NP_002414.1) fused with a His tag at the C-terminus.
Alternate Names: MMP7, MPSL1, PUMP1, Matrilysin, 3.4.24.23, Matrin, Matrix metalloproteinase-7, MMP-7, Pump-1 protease, Uterine metalloproteinase
SWISS: P09237
GeneID: 4316
Species: Human
Purity: ≥ 85 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: MMP-7,Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.Matrix metalloproteinases (MMPs) are a family of zinc and calcium dependent endopeptidases with the combined ability to degrade all the components of the extracellular matrix. MMP-7 (matrilysin) is expressed in epithelial cells of normal and diseased tissues, and is capable of digesting a large series of proteins of the extracellular matrix including collagen IV and X, gelatin, casein, laminin, aggrecan, entactin, elastin and versican. MMP-7 is implicated in the activation of other proteinases such as plasminogen, MMP-1, MMP-2, and MMP-9. In addition to its roles in connective tissue remodeling and cancer, MMP-7 also regulates intestinal alpha ‑defensin activation in innate host defense, releases tumor necrosis factor-alpha in a model of herniated disc resorption, and cleaves FasL to generate a soluble form in a model of prostate involution. Structurally, MMP-7 is the smallest of the MMPs and consists of two domains: a pro-domain that is cleaved upon activation and a catalytic domain containing the zinc-binding site.
Bio-Activity: Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 (RD,Catalog # ES001). The specific activity is >812 pmol/min/µg, as measured under the described conditions.
Source: CHO Cells
Tag: C-His
Formulation: Lyophilized from 0.22 μm filtered solution in 10mM HEPES, 5mM CaCl2,150mM NaCl (pH 7.5). Normally 8% trehalose is added as protectant before lyophilization.
Antigen Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
