Skip to product information
1 of 1

ABclonal

Recombinant Human/Mouse FGF-8B Protein - RP01659

Recombinant Human/Mouse FGF-8B Protein - RP01659

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human/Mouse FGF-8B Protein

Sizes: 10ug, 20ug

Catalogue Number: RP01659-10, RP01659-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human/Mouse FGF-8B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Arg215) of human FGF-8B (Accession #NP_006110.1) fused with and a 6×His tag at the C-terminus.

Alternate Names: HH6; AIGF; KAL6; FGF-8; HBGF-8; FGF8B

SWISS: P55075-3

GeneID: 2253 (B)

Species: Human/Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: In mammalian embryos, transient Fgf8 expression defines the developing isthmic region, lying between the midbrain and the first rhombomere, but there has been uncertainty about the existence of a distinct isthmic segment in postnatal mammals. Retinoic acid (RA) directly represses Fgf8 through a RARE-mediated mechanism that promotes repressive chromatin, thus providing valuable insight into the mechanism of RA-FGF antagonism during progenitor cell differentiation. Fgf8 encodes a key signaling factor, and its precise regulation is essential for embryo patterning.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details