Skip to product information
1 of 1

ABclonal

Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein - RP01164

Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein - RP01164

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01164-10, RP01164-20, RP01164-50, RP01164-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp32-Glu143) of Human/Mouse/Rat Irisin (Accession #NP_715637.2) fused with a 6×His tag at the C-terminus.

Alternate Names: FRCP2, irisin, FNDC5

SWISS: Q8NAU1

GeneID: 252995

Species: Human/Mouse/Rat

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its ability to induce p38 MAPK activation in 3T3 L1 mouse embryonic fibroblast adipose-like cells. 0.1 μg/mL of Recombinant Human Irisin can effectively induce p38 MAPK activation.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details