ABclonal
Recombinant Human/Mouse/Rat mature TGF-beta 3 Protein - RP00645
Recombinant Human/Mouse/Rat mature TGF-beta 3 Protein - RP00645
Couldn't load pickup availability
Recombinant Human/Mouse/Rat mature TGF-beta 3 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00645-10, RP00645-20, RP00645-50, RP00645-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human/Mouse/Rat TGF-beta 3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala301-Ser412(Tyr340Phe)) of human TGF-beta 3/TGFB3 (Accession #P10600).
Alternate Names: TGFB3, ARVD, ARVD1, LDS5, RNHF, TGF-beta3
SWISS: P10600
GeneID: 7043
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Transforming growth factor beta 3(TGFB3) is a member of a TGF - β superfamily which is defined bytheirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form ofTGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subsetofintegrins. It binds with high affinity to TGF- β RII, a type II serine/threonine kinase receptor. TGFB3 is involvedincell differentiation, embryogenesis and development.It is believed to regulate molecules involved incellularadhesion and extracellular matrix (ECM) formation during the process of palate development. WithoutTGF-β3,mammals develop a deformity known as a cleft palate.
Bio-Activity: Measured by its ability to inhibit the IL-4-dependent proliferation of HT-2 mouse T cells. The ED50 for this effect is 24.2-96.6 pg/mL, corresponding to a specific activity of 1.04×10^7~4.17×10^7 units/mg.
Source: HEK293 cells
Tag: No tag
Formulation: Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5. Contact us for customized product form or formulation.
Antigen Sequence: ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
