Recombinant Human MUC-1/CD227 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00129-10, RP00129-20, RP00129-50, RP00129-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human MUC-1/CD227 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Gly167) of human Mucin-1/MUC-1 (Accession #NP_001018016.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: ADMCKD, ADMCKD1, CA 15-3, CD227, EMA, H23AG, KL-6, MAM6, MCD, MCKD, MCKD1, MUC-1, MUC-1/SEC, MUC-1/X, MUC1/ZD, PEM, PEMT, PUM, MUC1, CA15-3, mucin-1, ADMCKD, ADMCKD1, CA 15-3, CD227, EMA, H23AG, KL-6, MAM6, MCD, MCKD, MCKD1, MUC-1, MUC-1/SEC, MUC-1/X, MUC1/ZD, PEM, PEMT, PUM, CA15-3, mucin-1
SWISS: P15941-11
GeneID: 4582
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. This protein is expressed on the apical surface of epithelial cells that line the mucosal surfaces of many different tissues including lung, breast stomach and pancreas. This protein is proteolytically cleaved into alpha and beta subunits that form a heterodimeric complex. The N-terminal alpha subunit functions in cell-adhesion and the C-terminal beta subunit is involved in cell signaling. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
Bio-Activity: Measured by its ability to increase beta-catenin levels in the cytoplasm and nucleus of HCT116 human colon adenocarcinoma cells. 0.01-1 ng/mL of Recombinant Human MUC-1 can effectively increase beta-catenin levels.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only