WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Myelin oligodendrocyte glycoprotein/MOFG Protein - RP01361

Recombinant Human Myelin oligodendrocyte glycoprotein/MOFG Protein - RP01361

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human Myelin oligodendrocyte glycoprotein/MOFG Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01361-10, RP01361-20, RP01361-50, RP01361-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Myelin oligodendrocyte glycoprotein/MOFG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly30-Gly154) of human MOG (Accession #NP_996532.2) fused with a 6×His tag at the C-terminus.

Alternate Names: BTN6, BTNL11, MOGIG2, NRCLP7, MOG, BTNL11, MOGIG2, NRCLP7

SWISS: Q16653

GeneID: 4340

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Myelin oligodendrocyte glycoprotein (MOG) is a transmembrane protein belonging to the immunoglobulin superfamily and contains an Ig-like domain followed by two potential membrane-spanning regions. MOG is expressed only in the CNS with very low content (approximately 0.1% total proteins) in the oligodendrogliocyte membrane. Three possible functions for MOG were suggested: (a) a cellular adhesive molecule, (b) a regulator of oligodendrocyte microtubule stability, and (c) a mediator of interactions between myelin and the immune system, in particular, the complement cascade. A direct interaction might exist between the membrane-associated regions of MOG and the myelin-specific glycolipid galactocerebroside (Gal-C), and such an interaction may have important consequences regarding the membrane topology and function of both molecules. It is considered that MOG is an autoantigen capable to produce demyelinating multiple sclerosis-like diseases in experimental animals.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human MOG at 1 μg/mL (100 μL/well) can bind Myelin oligodendrocyte glycoprotein Rabbit mAb with a linear range of 0.98-2.5 ng/mL

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only