Recombinant Human Myelin oligodendrocyte glycoprotein/MOFG Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01361-10, RP01361-20, RP01361-50, RP01361-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Myelin oligodendrocyte glycoprotein/MOFG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly30-Gly154) of human MOG (Accession #NP_996532.2) fused with a 6×His tag at the C-terminus.
Alternate Names: BTN6, BTNL11, MOGIG2, NRCLP7, MOG, BTNL11, MOGIG2, NRCLP7
SWISS: Q16653
GeneID: 4340
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Myelin oligodendrocyte glycoprotein (MOG) is a transmembrane protein belonging to the immunoglobulin superfamily and contains an Ig-like domain followed by two potential membrane-spanning regions. MOG is expressed only in the CNS with very low content (approximately 0.1% total proteins) in the oligodendrogliocyte membrane. Three possible functions for MOG were suggested: (a) a cellular adhesive molecule, (b) a regulator of oligodendrocyte microtubule stability, and (c) a mediator of interactions between myelin and the immune system, in particular, the complement cascade. A direct interaction might exist between the membrane-associated regions of MOG and the myelin-specific glycolipid galactocerebroside (Gal-C), and such an interaction may have important consequences regarding the membrane topology and function of both molecules. It is considered that MOG is an autoantigen capable to produce demyelinating multiple sclerosis-like diseases in experimental animals.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human MOG at 1 μg/mL (100 μL/well) can bind Myelin oligodendrocyte glycoprotein Rabbit mAb with a linear range of 0.98-2.5 ng/mL
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only