Skip to product information
1 of 1

ABclonal

Recombinant Human Neddylin/NEDD8 Protein - RP00059

Recombinant Human Neddylin/NEDD8 Protein - RP00059

Regular price $154.00 CAD
Regular price Sale price $154.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Neddylin/NEDD8 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP00059-10, RP00059-20, RP00059-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Neddylin/NEDD8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gly76) of human NEDD8 (Accession #NP_006147.1) fused with a 6×His tag at the C-terminus.

Alternate Names: NEDD8, NEDD-8

SWISS: Q15843

GeneID: 4738

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Neural Precursor Cell Expressed Developmentally Downregulated Gene 8 (NEDD8), also known as Related to Ubiquitin 1 (Rub1), is a 6-8 kDa member of the Ubiquitin family of proteins. Human NEDD8 is activated by a distinct NEDD8-activating (E1) enzyme, a heterodimeric complex composed of APPBP1 and UBA3 subunits. Activated NEDD8 is subsequently transferred to the UBE2M/Ubc12 or UBE2F NEDD8-conjugating (E2) enzymes. Through a process termed neddylation, the ROC1/Rbx1 RING Finger E3 ligase transfers NEDD8 to specific substrates. NEDD8 plays a critical regulatory role in cell proliferation and dysregulation of the NEDD8 pathway has been associated with several cancer pathologies.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.

Antigen Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG

Endotoxin: Please contact us for more information.

Research Use Only

View full details