Recombinant Human NKAT-1/KIR2DL1/CD158a Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01431-10, RP01431-20, RP01431-50, RP01431-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human NKAT-1/KIR2DL1/CD158a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His22-Arg242) of human KIR2DL1 (Accession #NP_055033.2) fused with a 6×His, Avi tag at the C-terminus.
Alternate Names: KIR2DL1, CD158A, KIR-K64, KIR221, NKAT, NKAT-1, NKAT1, p58.1
SWISS: P43626
GeneID: 3802
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Killer cell immunoglobulin-like receptor 2DL1 or KIR2DL1 is an inhibitory Natural Killer cell immunoglobulin-like receptor with two extracellular immunoglobulin domains. KIR2DL1 is a member of the Killer cell immunoglobulin-like receptor family whose members are classified by the number of the extracellular immunoglobulin domains and the length of the cytoplasm domain. KIR2DL1 is a transmembrane glycoprotein expressed by natural killer cells and subsets of T cells. KIR2DL1 down-regulates the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. It has been reported that the KIR2DL1 is bound to its class I MHC ligand, HLA-Cw4. The KIR2DL1-HLA-Cw4 interface exhibits charge and shape complementarity. Specificity is mediated by a pocket in KIR2DL1 that hosts the Lys80 residue of HLA-Cw4. Many residues conserved in HLA-C and KIR2DL receptors make different interactions in KIR2DL1-HLA-Cw4 and a previously reported KIR2DL2-HLA-Cw3 complex. A dimeric aggregate of KIR-HLA-C complexes was observed in one KIR2DL1-HLA-Cw4 crystal.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human KIR2DL1 at 1μg/mL (100 μL/well) can bind KIR2DL1 Rabbit pAb with a linear range of 1-99 ng/mL.
Source: HEK293 cells
Tag: C-His&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPR
Endotoxin: Please contact us for more information.
Research Use Only