Skip to product information
1 of 1

ABclonal

Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein - RP00277

Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein - RP00277

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP00277-20, RP00277-50, RP00277-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (His22-His245) of human KIR2DL3/CD158b2 (Accession #NP_056952.2) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: KIR2DL3, CD158B2, CD158b, GL183, KIR-023GB, KIR-K7b, KIR-K7c, KIR2DS5, KIRCL23, NKAT, NKAT2, NKAT2A, NKAT2B, p58

SWISS: AAB36590.1

GeneID: 3804

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human KIR2DL3 at 1 μg/mL (100 μL/well) can bind KIR2DL3 Rabbit pAb with a linear range of 2-54 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLH

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details