ABclonal
Recombinant Human NKG2-D/KLRK1/CD314 Protein - RP01530
Recombinant Human NKG2-D/KLRK1/CD314 Protein - RP01530
Couldn't load pickup availability
Recombinant Human NKG2-D/KLRK1/CD314 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01530-10, RP01530-20, RP01530-50, RP01530-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human NKG2-D/KLRK1/CD314 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile73-Val216) of human NKG2-D/KLRK1/CD314 (Accession #NP_031386.2) fused with a raFc tag at the N-terminus.
Alternate Names: KLRK1, CD314, D12S2489E, KLR, NKG2-D, NKG2D
SWISS: P26718
GeneID: 22914
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: KLRK1 (Killer Cell Lectin Like Receptor K1) is a Protein Coding gene. NKG2D, also known as CD314, is an immune receptor that consists of two disulfide-linked type II transmembrane proteins with short intracellular proteins incapable to transduce signals. To transduce signals, NKG2D needs adaptor proteins and it uses two adaptor proteins, DAP10 and DAP12. These two adaptor proteins associate as homodimers to NKG2D- therefore the entire receptor complex appears as a hexamer. NKG2D can send co-stimulatory signals to activate CD8 T cells. NKG2D also plays an important role in viral control. Cellular stress can induce ligands for NKG2D which results in the cell susceptible to NK cell-mediated lysis.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized human MICA (Catalog: RP00172) at 2 μg/mL (100 μL/well) can bind NKG2D with a linear range of 0.61-205.43 ng/mL.
Source: HEK293 cells
Tag: N-Rabbit Fc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALY ASSFKGYIENCSTPNTYICMQRTV
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
