ABclonal
Recombinant Human NKG2D ligand 2/ULBP2 Protein - RP00300
Recombinant Human NKG2D ligand 2/ULBP2 Protein - RP00300
Couldn't load pickup availability
Recombinant Human NKG2D ligand 2/ULBP2 Protein
Sizes: 20ug, 50ug
Catalogue Number: RP00300-20, RP00300-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human NKG2D ligand 2/ULBP2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly26-Ser217) of human ULBP-2 (Accession #NP_079493.1) fused with a 6×His tag at the C-terminus.
Alternate Names: ULBP2, ALCAN-alpha, N2DL2, NKG2DL2, RAET1H
SWISS: Q9BZM5
GeneID: 80328
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: ULBP2 Protein, Human, Recombinant (His Tag) consists of 203 amino acids with a molecular weight of 23.2 kDa. The apparent molecular mass of recombinant human ULBP2 is about 33 kDa in SDS-PAGE under reducing conditions because of glycosylation.NKG2D ligand 2 is cell membrane protein belonging to theMHC class I family.The gene for ULBP-2 resides in a cluster of ten related genes, six of which encode potentially functional glycoproteins. ULBPs are known to bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, gamma δ T cells, and CD8+ alpha beta T cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway.ULBP2 / N2DL-2 is not expressed in normal tissues, but in various types of cancer cell lines and the fetus and has been implicated in tumor surveillance.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ULBP2 at 2μg/mL (100 μL/well) can bind NKG2D with a linear range of 0.122-22.17ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
