ABclonal
Recombinant Human NovH/CCN3(N97K) Protein - RP01186
Recombinant Human NovH/CCN3(N97K) Protein - RP01186
Couldn't load pickup availability
Recombinant Human NovH/CCN3(N97K) Protein
Sizes: 10ug, 50ug, 100ug
Catalogue Numbers: RP01186-10, RP01186-50, RP01186-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human NovH/CCN3(N97K) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr32-Met357(Asn97Lys)) of human NOV/CCN3 (Accession #NP_002505.1) fused with a 6×His tag at the C-terminus.
Alternate Names: NOV, CCN3, IBP-9, IGFBP-9, IGFBP9, NOVh
SWISS: P48745
GeneID: 4856
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
