Skip to product information
1 of 1

ABclonal

Recombinant Human NovH/CCN3(N97K) Protein - RP01186

Recombinant Human NovH/CCN3(N97K) Protein - RP01186

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human NovH/CCN3(N97K) Protein

Sizes: 10ug, 50ug, 100ug

Catalogue Numbers: RP01186-10, RP01186-50, RP01186-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human NovH/CCN3(N97K) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr32-Met357(Asn97Lys)) of human NOV/CCN3 (Accession #NP_002505.1) fused with a 6×His tag at the C-terminus.

Alternate Names: NOV, CCN3, IBP-9, IGFBP-9, IGFBP9, NOVh

SWISS: P48745

GeneID: 4856

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details