Recombinant Human Osteonectin/SPARC Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00217-10, RP00217-20, RP00217-50, RP00217-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Osteonectin/SPARC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala18-Ile303) of human Osteonectin/SPARC (Accession #NP_003109.1) fused with a 6×His tag at the C-terminus.
Alternate Names: SPARC, BM-40, OI17
SWISS: P09486
GeneID: 6678
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: SPARC (secreted protein acidic and rich in cysteine), also known as osteonectin and BM40, is a secreted matricellular glycoprotein. SPARC is produced by fibroblasts, capillary endothelial cells, platelets and macrophages, especially in areas of tissue morphogenesis and remodeling.SPARC is involved in tissue renewal, tissue remodeling, and embryonic development and work by exerting counter-adhesive and antiproliferative effects that lead to changes in cell shape, disruption of cell adhesion, and inhibition of the cell cycle. SPARC is abundantly expressed in bone where it promotes osteoblast differentiation and inhibits adipogenesis. SPARC is highly expressed in many tumor types undergoing an endothelial to mesenchymal transistion; its expression, however, mainly decreases the likelihood of metastasis and confers sensitivity to chemotherapy and radiation.SPARC has also been linked with obesity and diabetes.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only