ABclonal
Recombinant Human PDGF-AA Protein - RP01772
Recombinant Human PDGF-AA Protein - RP01772
Couldn't load pickup availability
Recombinant Human PDGF-AA Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01772-10, RP01772-20, RP01772-50, RP01772-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human PDGF-AA Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser87-Thr211) of human PDGF-AA (Accession #NP_002598.4) fused with no additional amino acid.
Alternate Names: PDGF1; PDGF-A
SWISS: P04085
GeneID: 5154
Species: Human
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Platelet-derived growth factor alpha (PDGFA) is frequently upregulated in various cancers and thought to function as a key player in the development and progression of tumor growth by regulating aspects of cell proliferation, angiogenesis and metastasis. The human platelet-derived growth factor A chain gene (PDGFA) on chromosome 7p22 encodes an important mitogen. Within PDGFA lies a complex minisatellite structure that results in partial duplications of exon 4 and the IVS4 splice donor site.
Source: Pichia
Tag: No-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc, pH 4.5
Antigen Sequence: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
