Skip to product information
1 of 1

ABclonal

Recombinant Human PDGF-AA Protein - RP01772

Recombinant Human PDGF-AA Protein - RP01772

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human PDGF-AA Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01772-10, RP01772-20, RP01772-50, RP01772-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human PDGF-AA Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser87-Thr211) of human PDGF-AA (Accession #NP_002598.4) fused with no additional amino acid.

Alternate Names: PDGF1; PDGF-A

SWISS: P04085

GeneID: 5154

Species: Human

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Platelet-derived growth factor alpha (PDGFA) is frequently upregulated in various cancers and thought to function as a key player in the development and progression of tumor growth by regulating aspects of cell proliferation, angiogenesis and metastasis. The human platelet-derived growth factor A chain gene (PDGFA) on chromosome 7p22 encodes an important mitogen. Within PDGFA lies a complex minisatellite structure that results in partial duplications of exon 4 and the IVS4 splice donor site.

Source: Pichia

Tag: No-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc, pH 4.5

Antigen Sequence: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details