Skip to product information
1 of 1

ABclonal

Recombinant Human Phospholipase A2/PLA2G1B Protein - RP03277

Recombinant Human Phospholipase A2/PLA2G1B Protein - RP03277

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Phospholipase A2/PLA2G1B Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP03277-10, RP03277-20, RP03277-50, RP03277-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Phospholipase A2/PLA2G1B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ser148) of human Phospholipase A2/PLA2G1B (Accession #NP_000919.1) fused with His tag at the C-terminus.

Alternate Names: Phospholipase A2; PLA2G1B; PLA2; PLA2A; PPLA2

SWISS: P04054

GeneID: 5319

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Phospholipase A2 (PLA2) plays crucial roles in diverse cellular responses, including phospholipid digestion and metabolism, host defense and signal transduction. PLA2 provides precursors for generation of eicosanoids, such as prostaglandins (PGs) and leukotrienes (LTs), when the cleaved fatty acid is arachidonic acid, platelet-activating factor (PAF) when the sn-1 position of the phosphatidylcholine contains an alkyl ether linkage and some bioactive lysophospholipids, such as lysophosphatidic acid (lysoPA).

Bio-Activity: Measured by its ability to hydrolyze 1-Hexadecanoyl-2-(1-pyrenedecanoyl)-sn-glycero-3-phosphomethanol. The specific activity is >2500 pmol/min/μg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 10 mM Tris, 5 mM CaCl2, pH 8.0. Contact us for customized product form or formulation.

Antigen Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details