Skip to product information
1 of 1

ABclonal

Recombinant Human Placenta growth factor/PlGF-131/PlGF-1 Protein - RP02896

Recombinant Human Placenta growth factor/PlGF-131/PlGF-1 Protein - RP02896

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Placenta growth factor/PlGF-131/PlGF-1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02896-10, RP02896-20, RP02896-50, RP02896-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Placenta growth factor/PlGF-131/PlGF-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Leu19-Arg149) fused with a hFc tag at the C-terminus.

Alternate Names: D12S1900, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760, PGF, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760

SWISS: P49763-2

GeneID: 5228

Species: Human

Purity: ≥ 95% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Placenta growth factor (PlGF) is a member of the PDGF/VEGF family of growth factors that share a conserved pattern of eight cysteines (1, 2). Alternative splicing results in at least three human mature PlGF forms containing 131 (PlGF-1), 152 (PlGF-2), and 203 (PlGF-3) amino acids (aa) respectively (1, 2). Only PlGF-2 contains a highly basic heparin-binding 21 aa insert at the C-terminus (1). Human PlGF-1 shares 56%, 55%, 74% and 95% aa identity with the comparable isoform of mouse, rat, canine, and equine PlGF, respectively. PlGF is mainly found as variably glycosylated, secreted, 55-60 kDa disulfide linked homodimers (3). Mammalian cells expressing PlGF include villous trophoblasts, decidual cells, erythroblasts, keratinocytes, and some endothelial cells (1, 4-6). Circulating PlGF increases during pregnancy, reaching a peak in mid-gestation; this increase is attenuated in preeclampsia (7). However, deletion of PlGF in the mouse does not affect development or reproduction. Postnatally, mice lacking PlGF show impaired angiogenesis in response to ischemia (8).

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized human VEGFR1/Flt-1 (Catalog: RP01188) at 2 μg/mL (100 μL/well) can bind Human Placenta growth factor/PLGF-131(Catalog: RP02896) with a linear range of 0.17-41.1 ng/mL.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details