ABclonal
Recombinant Human Podoplanin/PDPN Protein - RP00208
Recombinant Human Podoplanin/PDPN Protein - RP00208
Couldn't load pickup availability
Recombinant Human Podoplanin/PDPN Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00208-10, RP00208-20, RP00208-50, RP00208-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Podoplanin/PDPN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu97–Lys199) of human PDPN/Podoplanin (Accession #NP_006465.3) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: AGGRUS, GP36, GP40, Gp38, HT1A-1, OTS8, PA2.26, T1A, T1A-2, T1A2, TI1A, PDPN, AGGRUS, podoplanin, GP36, GP40, Gp38, HT1A-1, OTS8, PA2.26, T1A, T1A-2, T1A2, TI1A
SWISS: Q86YL7-3
GeneID: 10630
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Podoplanin, also known as glycoprotein 36 (gp36), PA2.26 antigen, T1-alpha (T1A), and aggrus, is a 36 kDa type I transmembrane sialoglycoprotein and member of the Podoplanin family.PDPN is a mucin-type glycoprotein negatively charged by extensive O-glycosylation and a high content of sialic acid, which expresses the adhesive property. It is selectively expressed in lymphatic endothelium as well as lymphangiomas, Kaposi sarcomas, and in a subset of angiosarcomas with probable lymphatic differentiation. PDPN may contribute to form odontoblastic fiber or function as the anchorage to the tooth development and in proliferating epithelial cells of cervical loop and apical bud. The intensity of podoplanin expression is negatively correlated with the expression of CD34 and factor VIII. Podoplanin would be useful as a diagnostic marker for epithelioid hemangioendothelioma in liver tumors.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLEC-2 Protein at 5 μg/mL (100 μL/well) can bind Human Podoplanin with a linear range of 0.98-46 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
