WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Podoplanin/PDPN Protein - RP00208

Recombinant Human Podoplanin/PDPN Protein - RP00208

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human Podoplanin/PDPN Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00208-10, RP00208-20, RP00208-50, RP00208-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Podoplanin/PDPN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu97–Lys199) of human PDPN/Podoplanin (Accession #NP_006465.3) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: AGGRUS, GP36, GP40, Gp38, HT1A-1, OTS8, PA2.26, T1A, T1A-2, T1A2, TI1A, PDPN, AGGRUS, podoplanin, GP36, GP40, Gp38, HT1A-1, OTS8, PA2.26, T1A, T1A-2, T1A2, TI1A

SWISS: Q86YL7-3

GeneID: 10630

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Podoplanin, also known as glycoprotein 36 (gp36), PA2.26 antigen, T1-alpha (T1A), and aggrus, is a 36 kDa type I transmembrane sialoglycoprotein and member of the Podoplanin family.PDPN is a mucin-type glycoprotein negatively charged by extensive O-glycosylation and a high content of sialic acid, which expresses the adhesive property. It is selectively expressed in lymphatic endothelium as well as lymphangiomas, Kaposi sarcomas, and in a subset of angiosarcomas with probable lymphatic differentiation. PDPN may contribute to form odontoblastic fiber or function as the anchorage to the tooth development and in proliferating epithelial cells of cervical loop and apical bud. The intensity of podoplanin expression is negatively correlated with the expression of CD34 and factor VIII. Podoplanin would be useful as a diagnostic marker for epithelioid hemangioendothelioma in liver tumors.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLEC-2 Protein at 5 μg/mL (100 μL/well) can bind Human Podoplanin with a linear range of 0.98-46 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only