Recombinant Human PPIase A/PPIA Protein - RP00016

Recombinant Human PPIase A/PPIA Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00016-10, RP00016-20, RP00016-50, RP00016-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human PPIase A/PPIA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu165) of human PPIA (Accession #NP_066953.1).

Alternate Names: PPIA, CYPA, CYPH, HEL-S-69p

SWISS: P62937

GeneID: 5478

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.

Antigen Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only