ABclonal
Recombinant Human PPIase A/PPIA Protein - RP00016
Recombinant Human PPIase A/PPIA Protein - RP00016
Couldn't load pickup availability
Recombinant Human PPIase A/PPIA Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00016-10, RP00016-20, RP00016-50, RP00016-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human PPIase A/PPIA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu165) of human PPIA (Accession #NP_066953.1).
Alternate Names: PPIA, CYPA, CYPH, HEL-S-69p
SWISS: P62937
GeneID: 5478
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
