Skip to product information
1 of 1

ABclonal

Recombinant Human PRDX4 Protein - RP03163LQ

Recombinant Human PRDX4 Protein - RP03163LQ

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human PRDX4 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP03163LQ-10, RP03163LQ-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human PRDX4 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Trp38-Asn271) of human PRDX4 (Accession #Q13162) fused with His tag at the N-terminus.

Alternate Names: Peroxiredoxin-4; Antioxidant Enzyme AOE372; AOE37-2; Peroxiredoxin IV; Prx-IV; Thioredoxin Peroxidase AO372; Thioredoxin-Dependent Peroxide Reductase A0372; PRDX4

SWISS: Q13162

GeneID: 10549

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.

Background: Peroxiredoxin-4 (PRDX4) is a member of the AhpC/TSA family. PRDX4 is a cytoplasmic protein and contains one thioredoxin domain. PRDX4 exists in homodimer or heterodimer with PRDX1. PRDX4 reduces hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. In addition, PRDX4 is probably involved in redox regulation of the cell, regulating the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.

Source: E.coli

Tag: N-His

Formulation: Supplied as a 0.22 μm filtered solution in PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details