Skip to product information
1 of 1

ABclonal

Recombinant Human PRL-2 Protein - RP02140

Recombinant Human PRL-2 Protein - RP02140

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human PRL-2 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02140-10, RP02140-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human PRL-2 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Gln167) of human PRL2 (Accession #Q12974) fused with a 6xHis tag at the C- terminus.

Alternate Names: PTP4A2, HH13, HH7-2, HU-PP-1, OV-1, PRL-2, PRL2, PTP4A, PTPCAAX2, ptp-IV1a, ptp-IV1b

SWISS: Q12974

GeneID: 8073

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: PTP4A2, also known as PRL2 or PTPCAAX2, is short for Protein tyrosine phosphatase type IVA 2. This protein exists in cell membrane, cytoplasm,endosome and membrane. PTP4A2 is often farnesylated during post-translational modification. Farnesylation is required for membrane targeting and for interaction with RABGGTB. The unfarnesylated forms are redirected to the nucleus and cytosol. It can stimulate progression from G1 into S phase during mitosis and promotes tumors. It also inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 10mM β-ME, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details