ABclonal
Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein - RP01825
Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein - RP01825
Couldn't load pickup availability
Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01825-10, RP01825-20, RP01825-50, RP01825-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Thr 176-Lys 246) of human Pro-neuregulin-1/NRG1 (Beta1) (Accession #NP_039250.2) fused with no tag.
Alternate Names: GGF; HGL; HRG; NDF; ARIA; GGF2; HRG1; HRGA; SMDF; MST131; MSTP131; NRG1-IT2; Pro-neuregulin-1; NRG1 (Beta1)
SWISS: Q02297-6 (Beta1)
GeneID: 3084
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: neuregulin-1 (heregulin-1, NRG1) is a member of neuregulin family, which is comprised of four genes thatencode a large number of secreted or membrane-bound isoforms. All family members share an EGF-likedomain that interacts with the ErbB family of tyrosine kinase receptors. NRG1 isoforms can be classified intotype I, type II and type III isoforms. NRG1 directs ligand for ERBB3 and ERBB4 tyrosine kinase receptors,concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylationand activation of the ERBB receptors. NRG proteins show distinct spatial and temporal expression patterns andplay important roles during development of both the nervous system and the heart.
Bio-Activity: Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is typically 0.62-2.48 ng/mL, corresponding to a specific activity of 4.03×10^5 ~1.61×10^6 units/mg.
Source: E. coli
Tag: No-Tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
