ABclonal
Recombinant Human Prolactin/PRL Protein - RP01723
Recombinant Human Prolactin/PRL Protein - RP01723
Couldn't load pickup availability
Recombinant Human Prolactin/PRL Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01723-10, RP01723-20, RP01723-50, RP01723-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Prolactin/PRL Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Cys227) of human Prolactin/PRL (Accession #NP_000939.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: GHA1; PRL; PRL, Prolactin, Gha1, Prl1a1, AV290867, PRL
SWISS: P01236
GeneID: 5617
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Prolactin (PRL) is a hormone with multiple actions in the central nervous system (CNS) spanning from physiology to pathology. PRL exerts different actions through its receptors that can be found in both neurons and glial cells (astrocytes, microglia and oligodendrocytes) of the brain. It is generally believed that in vertebrates, prolactin (PRL) is predominantly synthesized and released by pituitary lactotrophs and plays important roles in many physiological processes via activation of PRL receptor (PRLR), including water and electrolyte balance, reproduction, growth and development, metabolism, immuno-modulation, and behavior.
Bio-Activity: Recombinant Human Prolactin/PRL Protein promote the proliferation using Nb2-11 cells. The ED50 for this effect is 0.08-0.30 ng/mL, corresponding to a specific activity of 3.33×106~1.25×107 units/mg.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
