Recombinant Human Proliferating cell nuclear antigen/PCNA Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01706-10, RP01706-20, RP01706-50, RP01706-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Proliferating cell nuclear antigen/PCNA Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe2-Ser261) of human Proliferating cell nuclear antigen/PCNA (Accession #NP_002583.1) fused with N-HA＆Strep tag at N-terminus.
Alternate Names: ATLD2; Proliferating cell nuclear antigen; PCNA
SWISS: P12004
GeneID: 5111
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Proliferating Cell Nuclear Antigen (PCNA) is a protein only expressed in normal proliferate cells and cancer cells. It is central to both DNA replication and repair. One of the well-established functions for PCNA is its role as the processivity factor for DNA polymerase delta and epsilon. PCNA tethers the polymerase catalytic unit to the DNA template for rapid and processive DNA synthesis. Two forms of PCNA exist in cells: (i) a detergent-insoluble trimeric form stably associated with the replicating forks during S phase and (ii) a soluble form in quiescent cells in G1 and G2 phases. PCNA forms a toroidal trimer in S phase with replication factor-C (RF-C) and DNA in an ATP-dependent manner and enables the loading of DNA polymerase delta and epsilon onto the complex. The close association of PCNA with kinase complexes involved in cell cycle machinery indicates that PCNA has a regulatory role in cell cycle progression. PCNA also participates in the processing of branched intermediates that arise during the lagging strand DNA synthesis.
Source: HEK293 cells
Tag: N-HA＆Strep
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: FEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only