ABclonal
Recombinant Human Prostate stem cell antigen/PSCA Protein - RP02245
Recombinant Human Prostate stem cell antigen/PSCA Protein - RP02245
Couldn't load pickup availability
Recombinant Human Prostate stem cell antigen/PSCA Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02245-10, RP02245-20, RP02245-50, RP02245-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Prostate stem cell antigen/PSCA Protein is produced by HEK293 cells expression system. The target protein is expressed with Prostate stem cell antigen/PSCA(Leu12-Ser86) fused with a His Tag at the C-terminal..
Alternate Names: PSCA, PRO232
SWISS: O43653
GeneID: 8000
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from sterile PBS, pH 7.4. Normally 5 % - 66 % trehalose is added as protectants before lyophilization.
Antigen Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
