Skip to product information
1 of 1

ABclonal

Recombinant Human Prostate stem cell antigen/PSCA Protein - RP02245

Recombinant Human Prostate stem cell antigen/PSCA Protein - RP02245

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Prostate stem cell antigen/PSCA Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02245-10, RP02245-20, RP02245-50, RP02245-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Prostate stem cell antigen/PSCA Protein is produced by HEK293 cells expression system. The target protein is expressed with Prostate stem cell antigen/PSCA(Leu12-Ser86) fused with a His Tag at the C-terminal..

Alternate Names: PSCA, PRO232

SWISS: O43653

GeneID: 8000

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from sterile PBS, pH 7.4. Normally 5 % - 66 % trehalose is added as protectants before lyophilization.

Antigen Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details