ABclonal
Recombinant Human PSA/KLK3 Protein - RP01540
Recombinant Human PSA/KLK3 Protein - RP01540
Couldn't load pickup availability
Recombinant Human PSA/KLK3 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01540-10, RP01540-20, RP01540-50, RP01540-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human PSA/KLK3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala18-Pro261) of human PSA/KLK3 (Accession #NP_001639.1) fused with a 6×His tag at the C-terminus.
Alternate Names: APS, KLK2A1, PSA, hK3, KLK3, APS, prostate-specific antigen, KLK2A1, PSA, hK3
SWISS: P07288
GeneID: 354
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: KLK3 (Kallikrein Related Peptidase 3) is a Protein Coding gene. The gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. It encodes a single-chain glycoprotein, a protease that is synthesized in the epithelial cells of the prostate gland and is present in seminal plasma. KLK3, also known as Prostate Specific Antigen (PSA), kallikrein-related peptidase 3, Gamma-seminoprotein, is a secreted protein of the glandular kallikrein subfamily of serine proteases. KLK3 contains one peptidase S1 domain. KLK3 is a glycoprotein produced almost exclusively by the prostate gland. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
Bio-Activity: Measured by its ability to cleave the colorimetric peptide substrate, Succinyl-Arg-Pro-Tyr-p- Nitroanilide (Suc-RPY-pNA). The specific activity is >160 pmol/min/μg, as measured under the described conditions.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
