Skip to product information
1 of 1

ABclonal

Recombinant Human PVR/CD155 Protein - RP00980

Recombinant Human PVR/CD155 Protein - RP00980

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human PVR/CD155 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00980-10, RP00980-20, RP00980-50, RP00980-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human PVR/CD155 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp28-Asn343) of human CD155/PVR (Accession #NP_006496.4) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: CD155, HVED, NECL5, Necl-5, PVS, TAGE4, PVR, HVED, NECL5, Necl-5, PVS, TAGE4

SWISS: P15151

GeneID: 5817

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD155 at 2 μg/mL (100 μL/well) can bind Human CD96 with a linear range of 0.1-76 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details