ABclonal
Recombinant Human R-spondin-1/RSPO1 Protein - RP00071
Recombinant Human R-spondin-1/RSPO1 Protein - RP00071
Couldn't load pickup availability
Recombinant Human R-spondin-1/RSPO1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00071-10, RP00071-20, RP00071-50, RP00071-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human R-spondin-1/RSPO1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg31-Ala263) of human R-Spondin1 (Accession #NP_001033722.1) fused with a 6×His tag at the C-terminus.
Alternate Names: RSPO1, CRISTIN3, RSPO
SWISS: Q2MKA7
GeneID: 284654
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects.
Bio-Activity: 1.Measured by its ability to enhance Cyclin D1 expression in HCT116 human colon adenocarcinoma cells. 0.1-10ng/mL of Recombinant Human RSPO1 can effectively enhance Cyclin D1 expression.|2.The intestinal crypts of mice were cultured in organoid culture medium containing factor combinations (100 ng/mL Noggin, Cat. RP01237 + 500 ng/mL R-spindin-1, Cat. RP00071) derived from ABclonal for144 hours, intestinal organoids were formed. (Customer Feedback Data)|3.Recombinant Human R-Spondin 1 protein stimulated Wnt signal pathway with Wnt-3a protein in HEK293T cells. After 6 hours, the stimulation when adding 300 ng/mL of R-Spondin-1 reached highest effect. Compared with only Wnt-3a stimulation, the Wnt signaling pathway was enhanced 3.1-fold after adding 300 ng/mL R-Spondin 1.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
