ABclonal
Recombinant Human RAMP3(M33L) Protein - RP00782LQ
Recombinant Human RAMP3(M33L) Protein - RP00782LQ
Couldn't load pickup availability
Recombinant Human RAMP3(M33L) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00782LQ-10, RP00782LQ-20, RP00782LQ-50, RP00782LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human RAMP3(M33L) Protein is produced by CHO Cells system. The target protein is expressed with sequence (Arg24-Val118) of Human RAMP3 (Accession #NP_005847.1) fused with His tag at the C-Terminus..
Alternate Names: RAMP3, Receptor activity-modifying protein 3, RAMP3-H
SWISS: O60896
GeneID: 10268
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: RAMP3 belongs to the RAMP family. Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL), calcitonin receptor (CALCR) and G-protein coupled estrogen receptor 1 (GPER1).Required for the transport of CALCRL and GPER1 receptors to the plasma membrane.Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner.Together with CALCRL, form a receptor complex for adrenomedullin/ADM and intermedin/ADM2.Together with CALCR, act as a receptor complex for amylin/IAPP.
Source: CHO Cells
Tag: C-8×His
Formulation: Supplied as 0.22μm filtered solution in PBS (pH 7.4).
Antigen Sequence: RAGGCNETGLLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
