WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human RBBP-4 Protein - RP00029

Recombinant Human RBBP-4 Protein - RP00029

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Human RBBP-4 Protein

Sizes: 10ug, 20ug

Catalogue Number: RP00029-10, RP00029-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human RBBP-4 Protein is produced by insect cell-baculovirus expression system. The target protein is expressed with sequence (Met1-Ser425) of human RBBP-4 (Accession #NP_005601.1).

Alternate Names: NURF55, RBAP48, lin-53, RBBP4, RBAP48, lin-53

SWISS: Q09028

GeneID: 5928

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Histone-binding protein RBBP4, also known as Retinoblastoma-binding protein 4, Retinoblastoma-binding protein p48, Chromatin assembly factor 1 subunit C, Chromatin assembly factor I p48 subunit, Nucleosome-remodeling factor subunit RBAP48 and RBBP4, is a nucleus protein which belongs to the WD repeat RBAP46/RBAP48/MSI1 family.It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human RBBP4 Protein at 1 μg/mL (100 μL/well) can bind RBBP4 Rabbit pAb with a linear range of 0.976-7.09 ng/mL.

Source: Baculovirus-Infected Sf9 Cells

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 500mM NaCl, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only