ABclonal
Recombinant Human REG-4 Protein - RP01398
Recombinant Human REG-4 Protein - RP01398
Couldn't load pickup availability
Recombinant Human REG-4 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01398-10, RP01398-20, RP01398-50, RP01398-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human REG-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Pro 158) of human REG4 (Accession #NP_001152824.1) fused with a 6×His tag at the C-terminus.
Alternate Names: REG4, GISP, REG-IV, RELP
SWISS: Q9BYZ8-1
GeneID: 83998
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Regenerating islet-derived protein 4, also known as REG-like protein, REG4, GISP and RELP, a member of the regenerating gene family belonging to the calcium (C-type) dependent lectin superfamily, has been found to be involved in malignancy in several different organs including the stomach, colorectum, pancreas and prostate. It is highly expressed in the gastrointestinal tract and markedly up-regulated in colon adenocarcinoma, pancreatic cancer, gastric adenocarcinoma, and inflammatory bowel disease. Expression of the Reg4 in different cell types has been associated with regeneration, cell growth and cell survival, cell adhesion and resistance to apoptosis. REG4 protein overexpression is associated with an unfavorable response to preoperative chemoradiotherapy and may be used as a predictive biomarker clinically. REG4 may play an important role in the development and progression of colorectal cancer, as well as in intestinal morphogenesis and epithelium restitution.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
