Skip to product information
1 of 1

ABclonal

Recombinant Human Renin/REN Protein - RP01175

Recombinant Human Renin/REN Protein - RP01175

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Renin/REN Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01175-10, RP01175-20, RP01175-50, RP01175-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Renin/REN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu24-Arg406) of human Renin (Accession #NP_000528.1.) fused with a 8×His tag at the C-terminus.

Alternate Names: REN, Renin, Angiotensinogenase

SWISS: P00797

GeneID: 5972

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human REN Protein at 0.5 μg/mL (100 μL/well) can bind Renin Rabbit pAb with a linear range of 1.9-302.7 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details